SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17591
Domain Number 1 Region: 345-373
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000162
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  281687.CJA17591
Domain Number - Region: 381-412
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00227
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 40-122,181-225
Classification Level Classification E-value
Superfamily ARM repeat 0.00691
Family PHAT domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17591
Sequence length 516
Comment (Caenorhabditis japonica)
Sequence
MLRYKKANVTKACKALTGVTEETELKIEMIQGTDTREVDKKEVENLLELISRKLETLNDT
MNDFSNAADEEDDNDEEVQKNIDKCISDAVHVIDRAHAAKDLLHVLRKQMEKGTDNQRTH
HTTTVDNPIESIPIQLLATQFQGNFGTTKIPKFSGKTWEFENFWTLFEELVHKNKHSNLL
KFNCLLQCLEGEAKELMKQMKVSNENYPQAVELLQKKYNNPEKIIRELTDKLQEDTAKNN
SIEEQRRVLDTTAITVKQLQDLGENLDCQLTKSKVIEKFNDHIQKEVYKKKLDIPRNEWT
TSKILIVLESVVSREEELQTTWKKKKQKEFPEEKDTDKSTKAKLKRQDRPLKCLFCKREG
HRARDCRTFSNPQQRKEILTKENRCYICTGIGHQTAECKRPLCYNCKGKHHSLICTKPPT
TEKRSTEKSPSTETNKQNTKTHALAQTFEVGANDDEDDSSENTVTVGGQMPTQVEPTLTN
CATQMTPTSRTKKRAFIPTVRLDALNPRKTKGKASP
Download sequence
Identical sequences CJA17591 281687.CJA17591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]