SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17831 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17831
Domain Number 1 Region: 253-548
Classification Level Classification E-value
Superfamily FAH 3.92e-97
Family FAH 0.00000000278
Further Details:      
 
Domain Number 2 Region: 157-251
Classification Level Classification E-value
Superfamily Fumarylacetoacetate hydrolase, FAH, N-terminal domain 2.48e-23
Family Fumarylacetoacetate hydrolase, FAH, N-terminal domain 0.0000791
Further Details:      
 
Domain Number 3 Region: 32-61
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000279
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  281687.CJA17831
Domain Number - Region: 106-154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0368
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17831
Sequence length 550
Comment (Caenorhabditis japonica)
Sequence
MKFEMLLAEAARANTILPQGLAVMPAPAPTHQPKKAKGECFYCGIPGHFANECRRRVKDR
ANGIFRRENKTGFNPRSQTGFNPRDQQTRSFPQNNPITNHQIFANQPTVQTIQSAVPALH
AQMDALKAELEVRQNQINALIRRNDELAGSAPVTQSSNARTTRHIGVAIGDEILNLGEIA
DLFDGPELKNHQDVFRQATLNEFMTLPRPAWLEARARIQQLLSADYPLLRDNTDLRSRAF
TSQSDAIMHLPAKIGDYTDFYSSIHHATNVGIMFRGKENALMPNWKWLPVGYHGRASSVV
VSGTELKRPVGQTKAPEATEPSFGPSKLMDFELEMAFFVGGPENSLGTRVPIEKSEDRIF
GVVLMNDWSARDIQAWEYVPLGPFLAKSFATTISPWIVSIEALRPYFVENPVQDPVPPQY
LRHDDPFTLDIELAVSIRPDGDSEEHVVCKTNFKHLYWTLKQQLAHHTVNGCNLRPGDLL
GSGTVSGPEEGAYGSMLELSWRGAKEVPVGNETRKFLKDGDEVNLSGTCTKNGVRIGFGE
CRGKLRPADV
Download sequence
Identical sequences CJA17831 281687.CJA17831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]