SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA18789 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA18789
Domain Number 1 Region: 155-247
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000774
Family Retroviral protease (retropepsin) 0.013
Further Details:      
 
Domain Number 2 Region: 96-138
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000013
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA18789
Sequence length 421
Comment (Caenorhabditis japonica)
Sequence
MTEDQAQCLLWIMGLQSHEHADLRARALRELEHDSRITLTELTDRLDQVIALRNDADFMG
GPSSTINAVNINRAKQQHHSSRKPLQTHPKSNNSFQSPNTPCYKCGQMHWARDCKLSSNT
VCRNCSKTGHLAKVCKSKRSVNNAILISQSSARNRNRIYHDVEIEGKKIKMQLDTGAEVT
LMNSKDWMRLNKPKLSQSTINLRLANNEPIKAKGQFKCNFTLNGHNGSGLCHVTETESLL
GLDWIAQDTTFYQHLIKASVNKISKVVPEAPPDTYKRTPQKIRKEGTTQEALQKFVMSYR
STPLQHLPQHSPHRQSLPKSSPARRLLSNVDRQSKPMDSLSSVDLPSQQMDLSSSDDISL
DDAAMDGSSSDGSTMDRAGPCAPVASSSSQGLAGHQPLRRSERAPKILSRLNMAPSGKSY
K
Download sequence
Identical sequences 281687.CJA18789 CJA18789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]