SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA19095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA19095
Domain Number 1 Region: 81-110
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000192
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 
Domain Number 2 Region: 145-178
Classification Level Classification E-value
Superfamily Acid proteases 0.00000976
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA19095
Sequence length 248
Comment (Caenorhabditis japonica)
Sequence
MIEWQLRGIPEEDQYDKCRKHAIVWEKGKIEMQQSKKLQHIPAKQTSTHHHAHQLQNVRM
NEKADSHGEKSNQWGFHMPTCSKSPAVTCYGCGEKGHIAPKCPKRTDKLKEQAHGNAVNA
VDKGKAKKSENSDEAETTILDVTQIQTGKIGSTEVKVLVDSGSTISLISKNIWQRLIREN
GKEWEKSIPKKAPEIRTVVAANDTIIKLLFEAKIETIMATRTRKIVYHIADVPLSFSEQM
RFEIWILP
Download sequence
Identical sequences 281687.CJA19095 CJA19095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]