SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA19647 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA19647
Domain Number - Region: 201-225
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000122
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA19647
Sequence length 515
Comment (Caenorhabditis japonica)
Sequence
MDEMTPETMDGRGARGTEDLELTVEDGHVGVKRRRKLWKNFAWFVNAADKVEEQVMEKLS
SVQRCTVRQQEMIVGPIVEFRKELSARFEEIGRDKWPRAVLRLMREQKLETVEELRALCE
RGSLEDRSSRTEGEENNQDELILFNEEKERLEARIRECETEKLRAEKLMCRAQRAVEEER
KTAEELNGSLKQVTREVERLRRYGRTNQCFRCGGVGHVVRQCTSRPVQKVDTAKKTRKAE
MVEPVESLGQRRRFKVESGSFVSAISTNGWERSKRRSSKWEKEVEVLAKPNFRGPPQSGA
PVRAKAKAGFGQFIRMETENECAPTSQSLKSEERKIAGADPLFIRRNQGIGVGSRSTTGC
PPKAAQVTLGKMGEDKTRCVPREQTRLVSDGQMVAKKVRREARRHVVNCAGESKISVEDP
DFCLRRTLEDRHGGVYTGKPDRDRLSSILLSAPETSDSMECLIDCSDRAVPEHESVTNRR
MGPSWSRKESRRDVDTLLRVRARRLERHRHVSSDK
Download sequence
Identical sequences A0A2H2JHP1
CJA19647 281687.CJA19647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]