SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA19667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA19667
Domain Number 1 Region: 539-582
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000366
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 
Weak hits

Sequence:  281687.CJA19667
Domain Number - Region: 616-648
Classification Level Classification E-value
Superfamily Acid proteases 0.000139
Family Retroviral protease (retropepsin) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA19667
Sequence length 664
Comment (Caenorhabditis japonica)
Sequence
MSHTNNLGADNGDDMVVPLVEHNEEHFAQNEMEFGGEEEDILLVSTEEFMIGLNQKREKR
KENDDRKIVSTIDYIRKLASMSRTQAEIMMRPIREAFQEKELIIERREDAWKFAVDKLTT
YQTIHEETENNVFQRDEEMEEIRARNADLESKVSSLQARIVELESESFGSRDEVGKVCEE
FNIQSSDELLRALIQKITIELKHTETLLELQDLKTKNEQLRQEARAAMERLKELELKTRM
LNEGKEEVERKLKVALDQAGQNTLMRRDHGRAELLSTTSHPGATGMKIEPTRGIEKARAY
ASLTGEIVESEEGEDTQSKGNLLEGNWTSTPRAEARMKQGNEKESLLEQILLAQAVPEPK
PFSASERSISLETFKHTFAMKYRTLPVYDQLMLLESKFLEGKALQGQTIEEFCLELDAIA
EKAFGRNSPEEISSTKTAKLLVAMGELSDDYQLRSLMEWQLREIPEERQYDECRKFATVL
EKGKLEMQKSRTKEKTHNQQVKQPSMPAQRLPSFRQNLSEVSKKEEAQFPNPIGRGEKRV
TFPSCGECDQLGYHLPTCSKAPTVSCYYCGGKGHYSIKCPKKLETPLEQRQGQTLAVEKL
ERRTAEAARGSGDIQIEIGKIGNTVMEFLIDSGSTISLISKTTWNKLVKGKWERMGKTDH
QICA
Download sequence
Identical sequences CJA19667 281687.CJA19667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]