SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA21045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA21045
Domain Number 1 Region: 56-300
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.1e-75
Family D-glucarate dehydratase-like 0.0000826
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.61e-17
Family Enolase N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA21045
Sequence length 312
Comment (Caenorhabditis japonica)
Sequence
MRLLNDHLVPLILNEDADCIEAIWRKLEFATHATTIGAITALALAAIDTALWDLRAKKQN
LPLWKLAGGAKDRCPLYTTEGGWLHIEKEALVEDALQAKAKGFSGSKVKIGKPHGSEDYA
RLSAVRAAVGDGFEIMTDCNQGFTVDEAIRRAERLKELDLAWIEEPLPADDLDGHIRLTR
STPTPIAVGESIYSIRHFREYMQKGACSIVQVDVARIGGITPWLKVAHAAEAFDIPVCPH
FLMELHVSLTCAVQNGRYVEYIPQLDDLTTKGMEIRDGHAIAPSEPGIGISWNWDVVRAR
SVSEFTREIVRS
Download sequence
Identical sequences 281687.CJA21045 CJA21045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]