SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA21228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA21228
Domain Number 1 Region: 901-1314
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.63e-133
Family Reverse transcriptase 0.0000187
Further Details:      
 
Domain Number 2 Region: 643-743
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000195
Family Retroviral protease (retropepsin) 0.02
Further Details:      
 
Domain Number 3 Region: 490-517
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000164
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA21228
Sequence length 1322
Comment (Caenorhabditis japonica)
Sequence
LRQTATFELTSEMDHPPQLSCETTRSANPTLFRDAVIKDLHLTHDRITNVYEDVCSRINE
LRITTESGAASTAVARIVHAQFERGQEVAPADSPQTQTLAVTTDHSLIKSYIPSPRGDTL
LKNPITAKPGKPIQAGGEMDITPTQLAAESDDTNVEATDTRKQQGRRNSRSSSATRRVTR
SMTASATPRVNVVSMKTNSSVPMFSGTTKENYHTFMRHFTDHVNIMPNPSNREIRNLLLT
VLTDFARDKAEEVLDSNPDATYEDVCTALRSQYENQYTTQARLDAIKNCFQYDQEPVQDY
YQRIRTSMREAQTGTNRQDVTKAAFEAFIEGLQPEIRFQVEMRQSNDLEEAFKDAIFAEK
ALNRKSKAVRTSQALAAAKCQQTAEVYAQAVQQHQAQFGYSRNNCTGGYSHNGTPNTEFP
AIAAFTPHRDARQGYPQGENAYRQPDNTFDQSRTPNRSFTHYPNRSFGNQRHAGNQRLNT
SQNLNYHQSPDANSTCWYCGIPGHFRQECRTRARDRAQGISRNSRLEAPFAPRRPNFPRN
HRSQTPLDPVENHRQPAVRVIETRHGAGSEEANIREQYNQQLKINQVQANRIKDISWRLH
AYQMGQDPSGLTQPNVNIIAPHEEESRVVTSCPVASSYVTAQIPIKANGHPCHALVDTGA
SITVTSESSHDLFCTLPMLPPTASSALGLGGNAVHMVGSAFIRFEIGECTIDHLTHYTKG
RCTPAGPKDYTFIIGNDVLSQIPTFRFDYAKGRFHVGNSVLPLDPTQQRVTFPAESESIV
DCTLNRKIKEQDMITHNASSHFEDAGLIVNPTVFNSAKITVLVTNPTHRDVTLPARTSVG
CAGRIYTDKEGNRLCLDTAFDELSPGVAAANALLPELHDDFKLNFDDIKCTNSEKYKLQQ
LCEKYPDVFSRNPYDLGSSRTDPVHIYTSTEVPIKGRAYRVPVKYQSELEQHINALLKSE
RITESNTPWTSPIVLVKKKNGSLRVCLDFRKLNEVTIPDNFPLPRIDAILEKVGGARYFS
SLDMANGYLQLRLDAQSSYKCGFVTESRVYAYTHLPFGLKSAASYFQRALKTVLAGMDDD
VMLYIDDILVYSQEFDQHIETLERVLKRFRQFNLKVSPKKCEFLKSSISFLGHTISRDNY
GPNHANVKTILETSTPKNLPETRRFVGMIGFFRKFIPQFSSIAEPLTRLNKKDEKFTWGP
EQEKAFNDLRQAIIEKPVLRFPDYEKPFHIFTDASSIGLGAALMQTEDADEKQYRPIAYA
SRTLASTETRWPAIQVEMLAIIFALRHFRPYICLSRIILHTDHRPLRYLLSKNKVNDNLA
SG
Download sequence
Identical sequences 281687.CJA21228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]