SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA21862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA21862
Domain Number 1 Region: 179-273
Classification Level Classification E-value
Superfamily Acid proteases 6.29e-16
Family Retroviral protease (retropepsin) 0.0094
Further Details:      
 
Weak hits

Sequence:  281687.CJA21862
Domain Number - Region: 117-163
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000436
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA21862
Sequence length 291
Comment (Caenorhabditis japonica)
Sequence
MVLLISPEDGEIFDKWFGRHEDTIKLDGADLDNTAKARFILTKLDKREAEQFRNHILPKS
PADVIALRNDANFIGGSSTVVHAVTNSSKRHHRHNKLFHQESAMAPPSSSTPSTPSFSTT
SSSQPCPKCCRIHGRQKCRVSKYTVCRNCNKAGHLARACQQKKTHVSNAIFIAHTSAAKH
NRIYTTVHINGKPIKMQLDTGAEATLLNVKDWERLNMPKLSPSSANLRTTTNAQIRVRGQ
LNCKFVLNGHHGSGRCLVTDTVSLLGMDWIAQDNHLYQLMQGKGRYSEAWL
Download sequence
Identical sequences CJA21862 281687.CJA21862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]