SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA22105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA22105
Domain Number 1 Region: 263-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000942
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA22105
Sequence length 418
Comment (Caenorhabditis japonica)
Sequence
MAATIVKLTSSEHQLPVASTSPNPLYYRPTRTSEVCEILFHWLKTAETSPKLLNKGFGGG
KQMDEMTPETMDGRGARGTEDLEFTVEDGHVGVKRRRKLWKNFARFVNAADKVEEQVMEK
LISVQRCTLSQREMIVGPIVEFSKELSARFEEIGRDKWPRAVFRLMREQNLETVEELRAL
CERGSLEDRSSRTEGEENNQDELIWFNEEKERLEARIRECEAEKLRAEKLMRRAQRAVEE
ERTTAEELNGSLKQVTREVERLRRYGRTNQCFRCGGVGHVVRQCTSRPVQKVDTAKKTRK
AEMGGPVESLRQRRRFKVESGSVVSAMSTNGWERSKRRNSTWEKEVEVLAKPNFRGPPQS
GVQGRAKAKAGLGQFIRMETEKQCVPTSLRLKSEEKKDREARQGVCRRLHNGQWILWT
Download sequence
Identical sequences 281687.CJA22105 CJA22105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]