SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA23120
Domain Number - Region: 279-322
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000889
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23120
Sequence length 741
Comment (Caenorhabditis japonica)
Sequence
MAQPYDPAYEGYEGRIPARQYPSQNPSRNNSWDEPRNQMYQVNPTEAARMIPQFDGTREG
YSNFIRIYDALVGSNAPAHWKFFVLSTKLTKCTHALSKLENPALAYEETRRRLKELFGST
ENSLKLSAELQRASVDRHNPEQMRTDLARIASIIDRMEQSEYGASRGDVFMFINKFPSDI
ARELTRFFRQGRNKTFREVWELACSVVEDLEITQDSTKRIPPSAYNPVPVMSLAAEPDDA
EDVNAYYARKAQPSRKCNFCDKACSRFYRTTYSGYDYINRATTAGVCLKCFRRGHTGAQC
THLHTTCRICGATDHSEQGCHFRAELIRSHQKQSKTGQPFHKGAGGHVSSNHPPEPYENV
VSADTSIPLPNPGYMETVDCPSLSTVMEAEPPPVNAEAREIFPALSTHTATEAEPPPINN
TDPREPRPQLSAQTASEVQQQFNYAADSPTVPSEIDEQCALCLCAAATGRRLPVVAKKKT
RFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLVCPSRVVYLRPPPVLSPPPISIASRDPCAHGFVGLARSLARLAGGFVACC
PRWFWTLVHMDSLAWLARWLAWLEDSWHAVPAGSGSVEMSLAVQMSLVELRATGRIRVRA
SGWTRVALAAPSSKTSAPSQN
Download sequence
Identical sequences CJA23120 281687.CJA23120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]