SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA23650
Domain Number 1 Region: 502-537
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000297
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Weak hits

Sequence:  281687.CJA23650
Domain Number - Region: 889-930
Classification Level Classification E-value
Superfamily DNA-binding domain of retroviral integrase 0.0353
Family DNA-binding domain of retroviral integrase 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23650
Sequence length 1007
Comment (Caenorhabditis japonica)
Sequence
MDHHVYKDILESKILPHYKAMGRGITFQQDNDPKNTSKFVKDWFLSRRIRVMDWPSQSPD
LNPIEKVWEELEKRMTGKRTRNVDENYQKLAEEWDKILQSVIDTLLDSMQRRCQAVIDTR
DFATKQVCEKVCGEACSEANESKDAEKVDKIDRKYQKLKSKLSECQINWEVERENLLEEL
ESEREKAQKLSESQERLKRKVVKLEKALVAEKQVSEDMKSHLKVWQERSKDDHGGKQKIH
ETWRKPRRTSRSSTNSSEASSWENRSETKTDTSRRSEVREMMDGMRRMMRAQALPEPGVF
DGDGDFGEFKRAFLLKYNNVTEGPEEMVAILEDKFLKGPAKTLFKTLPNRHNRSIKALFE
EFERKLRKRQGDSRTKALNEFENLRKSPNQKMWEYLIDVEKWSRKAYPGVDEGNLSQMRT
TKLMMAVKDNENLYNLLIMKRLDYSIENQYENLKDVVLQQEQEKRQSLKKGHSFLMNEAK
MRKDTSWRRSDYQLNQFKEEQKDEMGFRKEENQSQPDIKCFRCGGIGHMSRQCTSKPAYV
VERKKSEESEESQRKIDMSVRQAEKDVEVEVGHVEEKNVVVEVEDSVTGGESDERLGAGR
KVSVRGRRKLVKGFAQWLKNIEQVSEKVEKDLVVLTKCTKRQREGIIGPLKEFASELLER
FEEMGADRWPRSVLRVMKDFDLENVQDIRQVCEKVCGEACSEANESKDAEKVDKIDRKYQ
KLKMDVDMGKKLWLESKKECMPARLCSKNDEDMTVSVSNWRNEPVLIKKNQIVGVVSREW
KVCEGKEEKVVNMLNIDKKPSLKGEWRKKEVGRLLNETGEIPSGMFRRIISEFSEVFAIE
DSELTQTGIEECKVELEKDPSHKIKYPGVDDRVVIRIPAEKLRSKNPKLANEWQGPYRVL
KTTDNSAEVAPIIGNGKSLWVPWEQIRVVPKEVPEVKIETKAKRGRRAMHKDVVNQVPIW
EKDNFSVENMKFNKTTRRWKKNASTKHWSKEIDPLFGCSSDRDSIRK
Download sequence
Identical sequences 281687.CJA23650 CJA23650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]