SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA23753
Domain Number 1 Region: 279-373
Classification Level Classification E-value
Superfamily Acid proteases 3.01e-16
Family Retroviral protease (retropepsin) 0.0096
Further Details:      
 
Weak hits

Sequence:  281687.CJA23753
Domain Number - Region: 221-263
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00244
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23753
Sequence length 453
Comment (Caenorhabditis japonica)
Sequence
MDSNAMKLFLAQQKEAQQQQFNFFKEQQEQLLQTMIAALNTQKSEATAIINSLNSRIPTF
TYAPEDVETFDKWFGRHEDTIKLDGADLEDTAKARFVLTKLDKREAEQFRNHILPKSPAE
VNFEDTIQMLKKLFNETKSLTRLRYELLSVKFDGYDRKEYTGLVIALRNDAHFIGASSTV
VHAVTNSSKRHHRHNNVVHQESAMAPPSSSTPSTPSSSTTSSSHPCPKCCRIHGRQKCRV
SKYTVCRNCNKAGHLARACQQNKTHVSNAIFIAHTSAAKHNRIYTTVHINGKPIKMQLDT
GAEATLLNVKDWERLNKPKLSPSSANLRTITNAQIKVRGQLNCKFVLNGHHGSGRCLVTD
TVSLLGMDWIAQDNHLYQLLQGRGRYSKARAVAHTKPKDRHPAHAAIQKVLHKPQRSIEQ
PATDYSHSVVNPVTFVEKKDDQQLLGEMLRRES
Download sequence
Identical sequences CJA23753 281687.CJA23753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]