SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA23876
Domain Number 1 Region: 173-196
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000119
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23876
Sequence length 198
Comment (Caenorhabditis japonica)
Sequence
MSHEHPSNSQGPNPLIVPEAIAKIWRDQILEMVNSKVKIRQPEVAPKVTSKGMQHQLNFN
VRILNLVMDAQERNSENEELKKIEEEIRKRNQEIVLIDKSPETAGLLEKAAAMAAITSNG
QIDPAQMVMMAQLCSQDMRKRKHEDSQPWFRQTGVARGQSGVRDNRAQFRRVGERGQQVV
CYSCNQRGHYASDCRQSK
Download sequence
Identical sequences A0A2H2J1Y7
281687.CJA23876 CJA23876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]