SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA24593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA24593
Domain Number 1 Region: 164-258
Classification Level Classification E-value
Superfamily Acid proteases 9.27e-16
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 
Weak hits

Sequence:  281687.CJA24593
Domain Number - Region: 106-148
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA24593
Sequence length 370
Comment (Caenorhabditis japonica)
Sequence
MTEDQAQCLLWIIGLQSSEHLDLRLRALRELEINPSVTLSELADRLDQVSALRNDAHFIG
ASSTVVHAVTNSSKRHHRHNNVVHQESAMAPPSSSTPSTPSSSTTSSSHPCPKCCRIHGR
QKCRVSKYTVCRNCNKAGHLARACQQKKTHVSNAIFIAHTSAAKHNRIYTTVHINGKPIK
MQLDTGAEATLLNVKDWERLNKPKLSPSSANLRTTTNAQIKVRGQLNCKFVLNGHHGSGR
CLVTDTVSLLGMDWIAQDNHLYQLLQGRGRYSEARAVAHTKPKDRHPAHAAIQKVVHKPQ
RSIKQGQPQTTRTPSSTPSPSWRNKTINNCSGRCYDESRRKNKYNVNRHVTIPFITTCSC
HVVTYFPLYK
Download sequence
Identical sequences 281687.CJA24593 CJA24593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]