SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA25929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA25929
Domain Number 1 Region: 129-239
Classification Level Classification E-value
Superfamily Acid proteases 0.00000155
Family Retroviral protease (retropepsin) 0.076
Further Details:      
 
Domain Number 2 Region: 58-90
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000176
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA25929
Sequence length 295
Comment (Caenorhabditis japonica)
Sequence
MIDAKLLEYPEKEHYDTCRLLAVRHEMSLKESREKREARSERDGKMVTLDRKVRNFSNVL
PNSQSFPKVAVQCFKCGVYGHTARICPILAKAPVQRNALKEPNLKVESIDIKISDVQQGK
RGKKDVVRGRKMIEKGKIGSADVDFVIDSGSCISLMSMKTWSRILKINGVEWKKKVRKEK
TDLRTVFTAANEPIKLIEKVSVETAMRTRTRRLTFYVAAVDRETIILGTGAFKAMGVQLK
IDEPSRDVRIVDGVKLDRHGQKIVEIFVEGIIHEERRLCLITPTSKCLTAGSRKF
Download sequence
Identical sequences 281687.CJA25929 CJA25929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]