SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA26046
Domain Number 1 Region: 158-203
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000262
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 
Domain Number 2 Region: 244-352
Classification Level Classification E-value
Superfamily Acid proteases 0.0000225
Family Retroviral protease (retropepsin) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26046
Sequence length 769
Comment (Caenorhabditis japonica)
Sequence
MKFGTLPQEFQITLLETKCLEGKALKIFKGIPLDEKTTVEATLKAMASRLRVSVEDESPR
AKTKWEALRRIDGQSIEDFCLQLDKIARVAFSKTPPEELSSLKTAKLMSALAHNHTIRYM
IEVQLMDTEEVRHYDLCRMLATRFEFDVETSVERIEREKVRGCGECYQTGFHDPTCSRAP
RSNNVTCFKCGEKGHYSNKCPQSPLVAPIQVPEKLPVVRVEELSQSKAENPVVENVSEKL
GTPTVEKGKIGGVEVGIVIDSGATYSLIPKSMWKNIVEINRKDWEKKCAVKAPIFESVFT
ANNQPMKLIRQVKLETSLKTRTREVIYYVVGVERKTVIIGTDAFKLMGISINIQGVPREV
KRTRNIGLLSESEKSAKVLVEGVAEKQGDCLMTPLVESLVLAICKVKLNEKAALRSSDFG
KKNDVTDHGWGVELNERVGSPEFKAPIDHACSVEEETDAGMQKFSDLCTQLRQGREEKNQ
AICEFEKEYQTVFVLDGEDSGRISVAECEIELLKASQSNRQTPCPISLAVMPRAKKRVLK
EFSPSVNRKGYSLWSSAGALIEKKKIVLPMKWNYQFPYFFHATINRTSDGNPYVVITGRD
PQGPIKMDGEDADGINHSDVKKYKFFTTPKLPRAHRNAKKQARIELVEHNPRLIVSPKEL
QALVEKEYPQLSLSLILDTIRALKNVSSVAKLRIITTPVVDPEKVPLSEIRHSSKSEYVD
LTKLIEVIIKRKPIVFLLFVLFCTKSDSQVFLTGNTLLKRKKRTKGNTK
Download sequence
Identical sequences 281687.CJA26046 CJA26046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]