SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26081 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA26081
Domain Number 1 Region: 98-122,154-274
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.73e-30
Family D-glucarate dehydratase-like 0.0029
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.05e-29
Family Enolase N-terminal domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26081
Sequence length 275
Comment (Caenorhabditis japonica)
Sequence
MMKITAIETVQLPHLNNILWVRVHTDEGIVGLGETFRGANAVAAYIHSDIAPQLVGQNPL
EIDRISKLLLEPYVGFRSSGVEIRAASAIDIALWDIFGKLTNQPIHQLLGGLSRPSIRTY
NTCAGYTYNKSGARRYIGDQDDAKEGPYEDQLAFHRDAGALAESLLSEGITAMKIWPFDP
YAVASGGNFIHATDLDKALVPFRQIRDAVGDKMEIMVEFHSMWDLTSALAIARELKAFRP
FWSEDPIKMMNPQSLAVYAQQSGIPVCASETMATR
Download sequence
Identical sequences 281687.CJA26081 CJA26081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]