SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA26144
Domain Number - Region: 4-45
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0262
Family TFIIH p44 subunit cysteine-rich domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26144
Sequence length 58
Comment (Caenorhabditis japonica)
Sequence
KVILRCRECQKRRTWPLVVKAGDVNDVLCSPLENLIHDLLDICCGIQRTFQSRFYFVH
Download sequence
Identical sequences 281687.CJA26144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]