SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA26146
Domain Number 1 Region: 339-442
Classification Level Classification E-value
Superfamily Acid proteases 0.000000413
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 
Domain Number 2 Region: 285-319
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000454
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26146
Sequence length 730
Comment (Caenorhabditis japonica)
Sequence
MKSHLKVWQERSKDDHGGKQKIHETWRKPRRTSKSSTNSSEASSWENRSETKTDTSRRSE
VRDMMDGMRRMMRAQALPEPRMFDGEGDFGEFKRAFLLKYNNVTEGPEEMVAILEDKFLK
GPAKTLFKTLPNRHNRSIKSLFEEFERKLRKRQGDSRTKALKEYENLRKSPNQKMWEYLI
DVEKWSRKAYPGVDEGNLSQMRTTKLMMAVKDNENLHNLLIMKRLDYSIEDQYENLKDVV
LQQEQEKRQSLKKGHSFLMNEGKMRKETPWKRSDYHLNQFKNEQKDEMGFRKEENQSQPD
LKCFRCGGVGHMSRQCTSKPVYVVEKKKSEGVGVEVVETIEILGQNRKIIIDSGAVVSVM
SSAMWERLKKGCPDWEKRSEELAKPGFTILNASKAEMPVEKQLKLEVRVRGRKALVVFQL
VENSSEVLLLGTNAFKSIGVELKWKAENAVARAGERLRVPPQSCSQNEVIVDVDMGKKLW
LESKKECMPARLCSKNDEDMTVSVSNWRNEPVLIKKNQIAGVVSREWKVCERKEEKVVNM
LDIDKKPSLKGEWKKKNMGRLLNETGEIPSGMFRRSISEFSEVFAIEDSELTQTGIGECK
VELEKDPIHKIKYPGVGDRVLIRIPAEKLRSKNPKLANEWQGPYRVLKTTDNSAEVAPII
GVGDRVLIRIPAKKLRSKNPKLANEWQGPYRVLKTTDNSAEVAPIIGHVGFTQFRATWIL
FILSGPFGHF
Download sequence
Identical sequences CJA26146 281687.CJA26146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]