SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA26426
Domain Number - Region: 86-116
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00418
Family Retrovirus zinc finger-like domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26426
Sequence length 121
Comment (Caenorhabditis japonica)
Sequence
MTADEWSVFLFFRGLDAPGDAAAKIYLMQFTEMAERKGETITLSQIHDEWMRFLQIKQQT
KIVATSKQNPQAPVEVWKLEASKTKRSENSKFTPKWGSKDRRPPFCEYCKRAGHYILGIK
R
Download sequence
Identical sequences CJA26426 281687.CJA26426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]