SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA26472
Domain Number 1 Region: 102-137
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000963
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26472
Sequence length 138
Comment (Caenorhabditis japonica)
Sequence
MEPVKEVLLSNRNAELVLLLSNRNAELVLLDQDPGILAAKEKIDALKALTSESTGSTSAP
DMTSLLLFSQLSGNQRSQTDSRKRRIDTKDSQWFRGTDSFRGNGRVRDHQSQREGRADVK
CMRCHRFGHYANRCPQKR
Download sequence
Identical sequences 281687.CJA26472 CJA26472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]