SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA26568
Domain Number - Region: 40-62
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000628
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26568
Sequence length 66
Comment (Caenorhabditis japonica)
Sequence
ALELKAERYQAPEQTKSVQWKSSNRVEKTTRELKRLRRYGRANQCFRCGGVGHVVFDFPT
KPGASY
Download sequence
Identical sequences 281687.CJA26568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]