SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26928 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA26928
Domain Number 1 Region: 450-541
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000293
Family Retroviral protease (retropepsin) 0.013
Further Details:      
 
Domain Number 2 Region: 595-655
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000556
Family Retroviral integrase, catalytic domain 0.066
Further Details:      
 
Weak hits

Sequence:  281687.CJA26928
Domain Number - Region: 391-427
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 
Domain Number - Region: 281-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000262
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26928
Sequence length 763
Comment (Caenorhabditis japonica)
Sequence
MTKAQNEEALTEALAALMTQLASSNELHRQLLEENRALRDAASAAEPPRATAGGTRASNH
VRLMADLSRRIQKYSYTIGEPDSFMRWLTRHEPIFEEDGSELSEREKTRLLLGSLEETTF
HRFVDSQRDVEDIYDVTFKETLAALTKIFGAQRSLMVQRQACFHISRSSGNWEDPLEYTN
HIGQVVAGAKLATMTADEWSVFLFFRGLDAPGDAAAKIYLMQYTEMAERKGETITLSQIH
DEWMRFVQIKQQTKIVATSKQNPQAPVEVWKLEASKTKRRENPKFTPKWGSKDRRPPFCE
YCKRAGHYISKCFLKRKDEGTETQSIKVDVVNYTEMAERKGETITLSQIHDEWMRFVQIK
QQTKIVATSKQNPQAPVEVWKLEASKTKRRENPKFTPKWGSKDRRPPFCEYCKRAGHYIS
KCFLKRKDEGTETQSIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMITLINSKSWKF
IGRPPLEMVEHRISCANGSEMRVLGRARVTFALKGSEYKGYVYVREKNTNLIGMSWLSQS
PLMRKAMEVMVNQIEIPSAGMARLKDNPTVRRGNCQQNTKRTRITPSKPCPDTKKPWAHI
YVDFAGPINGFWFLVVEDAKTKYAEVKLTRKASAAATVDLIEDIFATHGYPDWIRKEEVS
SPCKQQLESEVQQDVSCVQPAPNLSQSLRRSQRNRRAPVRYDPCLELQSHSEDRAPKRGS
APYSDRAAARSRGLHIASNCRGKVLGRHMAALVGINVVTYTWK
Download sequence
Identical sequences 281687.CJA26928 CJA26928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]