SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA27243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA27243
Domain Number 1 Region: 276-381
Classification Level Classification E-value
Superfamily Acid proteases 0.000000221
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 
Domain Number 2 Region: 221-256
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000192
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Weak hits

Sequence:  281687.CJA27243
Domain Number - Region: 575-616
Classification Level Classification E-value
Superfamily DNA-binding domain of retroviral integrase 0.00785
Family DNA-binding domain of retroviral integrase 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA27243
Sequence length 693
Comment (Caenorhabditis japonica)
Sequence
MDGMRRMMRAQALPEPRVFDGEGDFGEFKRAFLLKYNNVTEGPEEMVAILEDKFLKGPAK
TLFKTLPNRHNRSIKSLFEEFEQKLRKRQGDSRIKALNEFENLRKSPNQKMWEYLIDVEK
WSRKAYPGVDDENLSQMRTTKLMMAVKDKENLHNLLIMKRLDYSIEDQYENLKDVVLQQE
QEKRQSLKKGHSFLMNEAKMRKDTSWRRSDYQLNQFKEEQKDEMGFRKEENQSQPDIKCF
RCGGIGHMSRQCTSKPAYVVERKKSEESEGVGAEVIETVEILGQNRKIIIDSGAVVSVMS
SAMWERLKKGCPDWEKRSEELARPGFTILNASKAEMPVEKQLKLEVRVRGRKAVVVFQLV
ENSSEVLLLGTNAFKSIGVELKWKAENAVARAGEKLRVPPQSCSKNEVIVDVDMGKKLWL
ESKKEWMPARLCSKNDEDMTVSVSNWRNEPVLIKKNQIVGVVLRECKVCERKEEKVGNML
DIDKKSSLKGEWRKKEVGRLLNETGEIPSGMFRRIISEFSEVFAIEDSELTQTGIGECKV
ELEKDPSHKIKYPGVDDRVLIRIPAEKLRSKNPKLANEWQGPYRVLKTTDNSAEVAPIIG
NGKSLWVPWEHIRVVPKEVPEVKIETKAKRGRRAMQKDVVNQVHLWVKDNFSVENMKFNK
GTRRWKKKSTTKHWSKEIDPLFGCSSDRDSIRK
Download sequence
Identical sequences 281687.CJA27243 CJA27243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]