SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA27741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA27741
Domain Number - Region: 198-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000126
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA27741
Sequence length 519
Comment (Caenorhabditis japonica)
Sequence
MALDVLDGTRTSGTKGSELSVEKRHVDVKQRRKLFKNFARFVDTADEVEKKVMENLLSVQ
SCTERQREMIVGPIEEFRKELWKRFEEIGRDKWPRSVLRLMREQKLQTVEGLREQCERGS
LVDRSSTKEGEENHQDELIWFKEEKERLEARIQECEAEKLRAEKLMRRAQRTVEKERKTT
EELSGSLQKVSRELERLRRYGRTNQCFRCGGVGHVVRQCTSRPVQKVDTAKKARKAKMVE
SVKIVGQRRRFEIDSGSVVSVTSTGGWGRSKRRSMKWEKEVEVLAKPNFRGPPQSGVQGR
AKAKAGLGQFIRMETEKQCVPTSLCLKSEERKVRAVVSNPLYIKRNQGIGVGSRSATRCL
PKAAQRTVDTVDMISQEKRWVPREQKRLVSDVQKGAKNGRREARRQAVNCAGKSEKSEFS
VENTELYLRRTLEDRHGGVCTVKPDRVRLSLISLSASEPVDSMECLVDSRDMAVQEHESV
TNRQRGRSRSRKESRRGVDTLLRARARRLERHRHVSSDK
Download sequence
Identical sequences CJA27741 281687.CJA27741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]