SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA28077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA28077
Domain Number 1 Region: 117-157
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000506
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  281687.CJA28077
Domain Number - Region: 68-108
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00213
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA28077
Sequence length 177
Comment (Caenorhabditis japonica)
Sequence
MTKDIILEKFSLRFREKAEDLQLDEEDWTIDQLLDKLDAFITREEKLNVKLNKPEPRPNN
SANQKSKTQSDGNPKSKEKDKGKPTPKCIYCKVEGSHYSNECSVIPGVKQRIEFLKEADR
CLQCAMKGHKVSDCKRNRKCYIFKETGHHSSICQKPNSAKTHNVYANFEASCNFYTN
Download sequence
Identical sequences A0A2H2IVM1
281687.CJA28077 CJA28077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]