SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA28132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA28132
Domain Number 1 Region: 200-225
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000767
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA28132
Sequence length 523
Comment (Caenorhabditis japonica)
Sequence
MDEMTPETMDGRGARGTEDLEFTVEDGHVGVKRRRKLWKNFARFVNAADKVEEQVMEKLI
SVQRCTVGQQEMIVGPIVEFRKELSARFEKIGRDKWPRAVLRLMREQKLETVEELRALCE
RGSLEDRSSRTEGEENHQDELIWFNEEKERLEARIRECEAEKVRAEKLMRRAQRAVEEER
RTAEELNGSLKQVTREVERLRRYGRTNKCFRCGGVGHVVRQCTSRPVQKVDTAKKARKAK
MVEPVEILGQGKRFEADGGSVVSVMSTGGWERLKTRCPELKKEAEVLAKPNFRGPPQSDA
KVRAKAKAGLGQFIWMETEKQCLPTSLCLKSEDRKVAGMVSNPLSIKRNQGIGVGSRCAT
KCSPKAAQVTVDTVDRMSEDKIRWVPREQTRVVSAVQMGAKKGRREARRQAFNCAGESEK
SEFSVENTDLSLRRTWEDRHGGVYTVKADRDRLLPISLSASDSSDSVEFLADCSDIAVPE
HELVANRRLGRSRSGKESRRDVDTLLRARARRLERHRHVSSDK
Download sequence
Identical sequences 281687.CJA28132 CJA28132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]