SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA28531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA28531
Domain Number 1 Region: 480-639
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000073
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 136-301,351-424
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000267
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA28531
Sequence length 642
Comment (Caenorhabditis japonica)
Sequence
MRLSACRAAALSTTMLTRRKSSIEGTKTERRRRGESIGGAFTDMINIEPTSIINKSTAFR
IYSVKSATIRSNRTEKLALMSETSAMLSSPTWPPRPLCEWCEFTALRTEIISKTDLPKYP
IPELLHERFLRDMVRIACLLSMISVCLHTPETIKLWPPLNYFILANDVIVTLIFIIEAAV
TANQNGLTDNPNSYLRDRWYQFEFFLLINHVLSCVIHVYELCTLWFPSLHLAYYPWLGAL
RSARPFIFLRFIRSIVRFKLPKNRIKLIMKRSSQQIQNVTIFFMFFVFSYAILGVQLFGR
LNYHCVVPETDPYNVTIRDLAIPDTMCSQPGAGGYECPSNMVCMRLQLKPQEEGFYGQFS
DFASSLFTVYLAASQEGWVYVLYDCLDSLPSFLAFFYFVTLIFFLAWLVKNVFIAVITET
FAEIRVQFSEMWQTREATSDHVYTQKLEKDEDGWKLVEVDKYNRAHSNNSLFLHTIVTSL
AFQTVMQLLILANAIFHATFVFYHDESDQIRKIWYYYVEVGFTVLFNTEVVIKIYAFGWK
AYIARGQHKFDCILCVGSSLNAIWYLYETNIFTYFQVFRIARLIKASPMLEDFVYKIFGP
GKKLGGLVIFTGILLIVTSAISLQLFCYVPNLNKFTNFPVVR
Download sequence
Identical sequences CJA28531 281687.CJA28531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]