SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA28632 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA28632
Domain Number 1 Region: 78-122
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000384
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000101
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA28632
Sequence length 203
Comment (Caenorhabditis japonica)
Sequence
MCESAMLQDMMLKGGKYVEQKWEKKESVNVNDLCEEWKKLLRQNSVVQEMEQVDKAVRAL
HTKKDFNRNHKKLWNREQSSGNVDECWNCGKVGHRKPDCVQRLTKCLKCQKTGHLSKYCK
SKGSKKAQSMVVIESAAAEDVEVNAVRQYVMVEVNDQLIEFQLDTGSDITLISRKDWMKV
GEPELEKCPMKVKSASGNEVKLL
Download sequence
Identical sequences 281687.CJA28632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]