SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA29053 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA29053
Domain Number 1 Region: 201-225
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000331
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA29053
Sequence length 375
Comment (Caenorhabditis japonica)
Sequence
MDEMTPETMDGRGARGTEDLEVIVEDGHVGVKRRRKLWKSFAWFVNAADKVEEQVMEKLI
SVQRCTVRHRKMIVGPIVEFRTELSARFEEIGRDKWPRAVLRLMREQKLETVEGLRALCE
RGSLEDRSSRTEGEENHQDELIWFNEEKERLEARIRKCEAEKLRAEKLMRRAQRAVEEER
KTAEQLNGSLKQVTRKLERLRRYGRTNKCFRCGGVGHMVRQCTSRPVQKVDTAKRARKAK
MVESVKILGQRRRFEIDSGSVVSMISTGGWQRSKRNSKWEKEVEVLAKPNFRGPPQSGAQ
VRAKAKAGFGQFIRMETENGCVPTSQSLKSEQRKVAGVNPLFIKRNQAIGVGSRSAARCS
PKTTQVTVDTVDWMS
Download sequence
Identical sequences A0A2H2IWH0
281687.CJA29053 CJA29053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]