SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA29202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA29202
Domain Number 1 Region: 649-1075
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-123
Family Reverse transcriptase 0.0000528
Further Details:      
 
Domain Number 2 Region: 1255-1412
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-40
Family Retroviral integrase, catalytic domain 0.0059
Further Details:      
 
Domain Number 3 Region: 508-600
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000137
Family Retroviral protease (retropepsin) 0.0094
Further Details:      
 
Domain Number 4 Region: 437-483
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000366
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA29202
Sequence length 1570
Comment (Caenorhabditis japonica)
Sequence
MPRDITTGDQELAMADLTKQISTLVAALSKLTQVGTASEQHSTDTTKLADAISSRIPMFV
YEPEDGRTFDSWYSRYKDTITKDGFSLQDDVRTRLVISKLDTKQYSHYANRILPKVPSEL
SYEDTIAKLKETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEYHGSSIEEYTGTVLRRFASSDFKSMT
DDQLCCMVWINGLRDPAHIDIRTRALQTMESRPDVTLLQLESEIKRLLDLRADSKCVAGS
TPSHAAEINAIFRKQQRDNNREQGPPSACYRCGGPHWARDCNVKDVKCSKCGKTNHMAKF
CRFQDKTKPYQKKKVKSVIISLASSSGASRIYRKVFINSKPLRMQLDTGADITLINTKDW
AKIGKPKLDKPSIKVKSATGQPINVKGSFTCDFTINGNSATGTAHVADTDTLLGIDWISK
DTQLWNLLQENHQINAAFSVIGSACNYLDDTREKLKFDLKSEYPIIFQPGLGKCTKTKAS
IRLKPGAQPVFRKARPVPYATLPTITEELDRFVQEGIATPIDHAQWAAPVVPIRKKNGSL
RMCADFSTGLNDAIESHQHPLPTADDIFATLNGGKHFSQIDLAEAYFQIELDEDSKNLLC
INTHRGLFQFNRLPFGVKPATAIFQQVMDSMISGIEGAAAYLDDIIISGGTVEEHNSRVK
AVMQRIADYGFRIRIEKCKFLMKQIVFLGFVIDEHGRRPDPEKVADIQKMPAPTNVSQLR
SFLGLIQFYGAFVKELFELRPPLNELTKKDQEFIWSPKCQKAFERIKEILQSDLLLTHFD
PKLPIIVAADASQYGIGSVLTHRFPDGSEKAIYHNSQALTAAQRNYSQIEKEALGLVTAV
TKYHRFIHGRHFTLRTDHKPLLSIFGDKKGVPVYSANRLQRWATILLNYDFSIEYVNTHD
FGQADALSRLIAEQSQSKEVEDQVIGQVECEVIANLVSTCNSLPVTVDMISSASTKDAII
AEAINHVKHNSWPNKMDHGSILWNFFNRREQLSIVKDCLMLGDRVVIPTALRHRVLKMLH
RAHPGMVRMKQLARSFVYWPSLDKDIESTVRSCDDCAAAAKDPIKNTLCSWPTPTAPWTR
VHADYAGPIEGTYYLVIVDSYSKWPEVIATKSITSTSTISIFRKVFAQFGNPKTLVTDNG
TQFTSTQFINFCKEHGIQHIRSPPFHPQSNGQAERFVDTMKRALRKLQGEGNADTAIQVF
LQNYRSTPCEASPHYLSPAENFIGRKIRTTLDLLLPSSESPTARNDSMEAQFNRHHGARE
RMFQEHDKVYVKDFRNPQNATWISGVVQKRIGRTLYKVLVNGSVWKRHTNQLRRRDIAPF
AGSTDIWYLDVVTPSRADNSNQLPSTTQPTPASPTSPRLIAPTQPTIRTSTRHRNPVKKL
DIDPRTKSYK
Download sequence
Identical sequences 281687.CJA29202 CJA29202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]