SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 282459.SAS2232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  282459.SAS2232
Domain Number - Region: 115-189
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0141
Family D-glucarate dehydratase-like 0.048
Further Details:      
 
Domain Number - Region: 170-252
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0337
Family ABC transporter transmembrane region 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 282459.SAS2232
Sequence length 410
Comment (Staphylococcus aureus aureus MSSA476)
Sequence
MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGIMAYVLLAAILG
SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGRLALITSYIPFLAPFQLVVRAQTS
GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
Download sequence
Identical sequences A0A0H3K4A2 A0A2H4QPY6
196620.MW2260 282459.SAS2232 gi|21283989|ref|NP_647077.1| WP_000548705.1.101330 WP_000548705.1.101406 WP_000548705.1.101598 WP_000548705.1.102066 WP_000548705.1.11228 WP_000548705.1.1457 WP_000548705.1.15241 WP_000548705.1.15753 WP_000548705.1.17050 WP_000548705.1.18567 WP_000548705.1.19022 WP_000548705.1.20690 WP_000548705.1.2434 WP_000548705.1.24503 WP_000548705.1.28866 WP_000548705.1.28915 WP_000548705.1.29315 WP_000548705.1.29716 WP_000548705.1.30496 WP_000548705.1.31212 WP_000548705.1.31426 WP_000548705.1.31505 WP_000548705.1.33765 WP_000548705.1.36932 WP_000548705.1.38390 WP_000548705.1.38862 WP_000548705.1.38960 WP_000548705.1.43530 WP_000548705.1.44899 WP_000548705.1.46195 WP_000548705.1.47493 WP_000548705.1.47541 WP_000548705.1.47629 WP_000548705.1.53323 WP_000548705.1.53418 WP_000548705.1.54446 WP_000548705.1.57196 WP_000548705.1.57723 WP_000548705.1.58419 WP_000548705.1.58538 WP_000548705.1.61009 WP_000548705.1.61897 WP_000548705.1.64994 WP_000548705.1.65046 WP_000548705.1.6612 WP_000548705.1.74273 WP_000548705.1.74761 WP_000548705.1.76149 WP_000548705.1.78598 WP_000548705.1.79270 WP_000548705.1.81010 WP_000548705.1.83066 WP_000548705.1.85160 WP_000548705.1.85292 WP_000548705.1.8551 WP_000548705.1.86606 WP_000548705.1.87272 WP_000548705.1.88753 WP_000548705.1.88761 WP_000548705.1.9055 WP_000548705.1.9071 WP_000548705.1.90923 WP_000548705.1.92918 WP_000548705.1.92960 WP_000548705.1.93736 WP_000548705.1.97444 WP_000548705.1.98497 gi|49487122|ref|YP_044343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]