SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 283166.BH09080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  283166.BH09080
Domain Number - Region: 54-90
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0126
Family IMD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 283166.BH09080
Sequence length 95
Comment (Bartonella henselae Houston-1)
Sequence
MSWNEALLVVFVVLLLFSGVMLFALYYRHQAKNLKDELEERKREVLIETKAIIDQCAADL
KRYDAEIKVRDEEIEKLQQDLKRLEEEAKANSHII
Download sequence
Identical sequences A0A0G2Q8K8 X5M4A4
WP_011180678.1.16088 WP_011180678.1.16224 WP_011180678.1.16800 WP_011180678.1.20053 WP_011180678.1.28492 WP_011180678.1.31727 WP_011180678.1.4240 WP_011180678.1.60777 WP_011180678.1.67260 WP_011180678.1.68342 WP_011180678.1.77700 WP_011180678.1.8075 WP_011180678.1.83501 WP_011180678.1.8516 WP_011180678.1.87377 WP_011180678.1.88456 WP_011180678.1.95042 gi|49475547|ref|YP_033588.1| gi|49475668|ref|YP_033709.1| 283166.BH07770 283166.BH09080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]