SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000000313 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000000313
Domain Number 1 Region: 965-1135
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.11e-46
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.012
Further Details:      
 
Domain Number 2 Region: 820-961
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.5e-40
Family Poly(A) polymerase, PAP, N-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 266-327,371-464
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.44e-33
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.05
Further Details:      
 
Domain Number 4 Region: 110-300
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.45e-25
Family Poly(A) polymerase, PAP, N-terminal domain 0.053
Further Details:      
 
Domain Number 5 Region: 1162-1191
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000837
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 6 Region: 781-806
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000279
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000000313
Domain Number - Region: 77-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000765
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000000313
Sequence length 1205
Comment (Anolis carolinensis)
Sequence
AEMEDGSCKETQQRRKPRRPRRMRKEENDQDEEIDGPVIDESVLTAKELLGLQQAEERLK
RDYIYRLRKRPRSYPTAKYTCRLCDALIESVAFAHKHIKEKRHKKNIKEKQEQQLLTALP
PPTLLQIEAIGIAIEKVVQEFGLNNEDLEQRLGIKATMENILHKKLPECSLRLYGSSSSR
FGFKNSDVNLDIQFPASMSQPDVLLLVQESLKNSESFIDVDADFHARVPVVVCKEKQSGL
VCLVSAGNENAFLTTNHLATLGKLEPHLVSLVIAFRYWAKLCCADRPEEGGLPPYVFALM
VIFFLQQRKEPFLPVYLGSWVSGFSLNKLVNFNLKEVEDDIVVWEHSPPIDDPTSSKETS
PKRGKVYIGSVPLVFNSDHQCLIPVGQLWVELLRFYALEFNLADLVISIRLKEKVSRESK
DWPKKRIAVEDPYSVKRNVARTLNSQLVYEYILHCLRATYKYFAMPHKQSTKNNQKTPLE
TLAVPEPERTKNIAGSCTSATNTSLYFPQEHMYESSQGFGAEIFVEEQLTDEMSHLGISH
GDSDCIIEEFISGDNEEFKPSCEETESGNEEEEEEEEEEEEHDHVIKWQGHLDTNQVPTC
EHDVETDSVSDLESFQNTITPLDDLGLQCCGVLDGKIDDEESTEDTDELDESLIKLEPAT
QEQVFEMDNSEEEVEADEEDDEEEHSIVNQRHGNIINTEDELDNTFTGSGMEEALSEEEP
FSSVKYEDSELRKCADELPRIDLNKEECSEKEVFSESNITVDQCSKPEFFYEFNKSVFTK
GKSPTVVCSLCKREGHLKKDCPEDFKKIELDPLPPLTPKFSSTLDQVCVQCYKDFSPNVI
EDQAREYIRHNLESFIQQEFPGTKLNLFGSSKNGFGFKQSDLDICMTIDGLETAEELDCI
KIIEELARVLRKHSGLRNILPITTAKVPIVKFFHVRSGLEVDISLYNTLALHNTRLLSCY
AAVDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRSPPVIPVLQEICK
EPKKPEILVDGWNVYFFDKMDELPTVWPDFGKNKESVGELWLGLLRFYTEEFDFKEHVIC
IRRKNLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGTPIRG
IPKEYPSKMEYFFDPEVLTEGELAPNDRCCRICGKIGHFMKDCPMRRKLRRRHDSEDPQN
QRYTE
Download sequence
Identical sequences 28377.ENSACAP00000000313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]