SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000001428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000001428
Domain Number 1 Region: 184-328
Classification Level Classification E-value
Superfamily Cap-Gly domain 7.99e-40
Family Cap-Gly domain 0.00000022
Further Details:      
 
Domain Number 2 Region: 39-151
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.7e-33
Family Cap-Gly domain 0.00000486
Further Details:      
 
Domain Number 3 Region: 821-1071
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000915
Family Tropomyosin 0.00037
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000001428
Domain Number - Region: 1395-1424
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0942
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000001428
Sequence length 1429
Comment (Anolis carolinensis)
Sequence
MSMLKPSGLKAPTKISKPGSVLLKTAASTSPAATEKAAAAEKASTTSPSEAQEEFVDDFR
IGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEAIGKNDGSVAGVRYFQCEALRGIFT
RPSKLTRKVVTEEEPNGTQAAAASRATSPTSTSAASLASPLPPTSIPHKTSSPVAKEHPV
SQVSNLSRTASESISNLSEAGSLKKGERELKMGDRVLVGGTKAGVVRFLGETDFAKGEWC
GVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKTTVRKAIPTP
TSLKRSPSASSLSSLSSVASSVSSKPSRTGLLTETSSRYARKISGTTALQEALKEKQQHI
EQLLAERDLERAEVAKATSHVGEIEQQLALARDGHDQRMLEMETKMDQLRALVEAADREK
VELLNQLEEERRRVEDLQFRVEEESITKGDLENEKKRVSSYIEVTQTKLEHARIKELEQS
LLFEKTKADKLQRELEDTRVATVSEKSRIMELEQDLLLRETEVKELRAKLESSKPAGDVD
TSLSLLQEISTLQEKMVTMSKEHEDELKALKEKFDTNEESFQTEMKAWLATKENMAKESE
SLKMKLVGAQKENAEVTNLWKLKLESAIASHQQAMEELKTSFSKGAGAQSAEYAELKIQI
EKMRAEHKSEISDLKAQQENERSHLSKEADALKEKLKEVAEENEKSLEALKTKLEKAEEQ
HLIELEDNLNKLQEAEIKVKELEGLQSKCTEQAEAIDSFKAQLKATEAKLLELDALQMAS
SEGKLQLERYSKELEAAEKKIQRLENERSSESSQAVSLVKELEGKEQKLLELESHLVAVN
QHKDALEKELEELKGKFSKGADEAESVQKSMQETVEKLSQKEQQFAKMSSELDLLRSNLA
DMEKKLKDREDKEKQLTEAKAKLESDLAEIMKSSGDSSLQLTKMNEDLRQKENKIKELQL
QLNKATESAARLKETARNAEEAQREGQKKHQTEVKEMQAKLGNLEKQLTASQNQCKDLQV
THEKALSGSATKHDAAIKKIKQKLHDTEQQLASAQQKNTDLEKQTKEMKKEAKDSKTAQT
AEDALQIVEQEALQREKMETLASLEDLKRANQKLQKELESLKEKNLRSQEELDTSLKLRD
MENQKMDDIRQELEALKLAEAEKSQQFAALQEENVKLAEELGKGEVTSHQKLDEERSVLN
NQLLEMKKRESDLKRDIDEERASLQKSISITSALITEKDEELEKLRNEVTVLRGENATAR
NLHSLVQSLESDKLKLELKVKNLEQKLKETQKASGSSGTFLILSLSFFPLETLQIDFLNS
VIVDLQRKNDDLKAKLEMMSESALNGNEEEVPQYDSEGESQVKKKPRLFCDICDCFDLHD
TEDCPTQEQAADEPPHSTYHGSRNEERPYCDICEVFGHWPSNCNDDETF
Download sequence
Identical sequences 28377.ENSACAP00000001428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]