SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000001537 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  28377.ENSACAP00000001537
Domain Number - Region: 154-180
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000108
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000001537
Sequence length 635
Comment (Anolis carolinensis)
Sequence
ELRRKLNILTRPSGLTIDDAKVDGPLLQILSMNNNVSKQYHQEIEDFIVSLVQRYEEQQR
AEPDKTYFSLKPQPSSFVLEEDPKVTSANMSKKIKEAFSVIGSVLYFTNFCLDKLGQPIL
NENPQLTDGWEIPKYQQVFTQILSLDGQEIQVKPKRPKPHCFNCGLEDHQMKDCPQPRNA
ARISEKRKQFMDACGEANNQNFQQRYHADEIDERFGRFKPGIISEELQDALGVTEKSLPP
FIYRMRQLGYPPGWLKEAEMEKSGLTLYDGKEGRNINTEEDDYNLSRRVTYDISKLINYP
GFNMSTPNGVSDEWRLFGSVPLQPSQQKDIFAHYLSTYRSAGSKSNSKRLSSHQSSHRSK
RQKGNNAEVSSADMEMDSDFEMVQNSPNYDGFQFQPPLPPGSPLNAIPPPLPRGTPPATP
PNFTPPPTSNNSPAVRAEGSAMDEDTLTLEELEEQQRLIWAALEQADGTNSDSDLPGGTP
LTGNSVSSSPSRAEPEVLLEEVTHKNVEVLEPELSDDMELKPKVEESENKATELVDLTKE
EELDGVDSEKMAENCLSTSVNEVNHEKGGGDNPVAHGADMALKITSPIPDMSKFAAGITP
FEFENMAESTGIYLRIRSVLKNSPRNQQKNKKSSL
Download sequence
Identical sequences 28377.ENSACAP00000001537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]