SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000004063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000004063
Domain Number 1 Region: 5-169
Classification Level Classification E-value
Superfamily RNase III domain-like 4.71e-16
Family RNase III catalytic domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 172-250
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000116
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000004063
Sequence length 273
Comment (Anolis carolinensis)
Sequence
RSEKPNWDYHAEIQAFSHRIHEKFSLDLLKTAFVNHCYIKHEESRRQVLGLEKEAIALNL
KDNHELYLQGNSFSHLYLRQCFEEAYPKMPPAGIEALVNFLTSEELVSYLAQNLSLQDLT
LCAEFPVPTNVLQQTFFAVIGALLQSSGSQRTKLFVRDFFIPQLIGKELFEMWNVINPMG
LLMEELTKRNISAPEPRLTRQSGASTALPLYFVGLYCNKKLLAEGTGETILAAEEEAARV
ALRKLYGFTENRHPWDYSSPKWEQRAENAISSS
Download sequence
Identical sequences 28377.ENSACAP00000004063 ENSACAP00000004063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]