SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000004840 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000004840
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-19
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000004840
Sequence length 222
Comment (Anolis carolinensis)
Sequence
MALVKSGWLLRQSTILRRWKKNWFDLWSHGHLLFYDDQNRHDLEDRIHMKVDCINVRVGD
ECRGLQPPEGKPQDCLLQIICRDGKVLSLCAESADDCLAWKFALQDARTNEAYIGSEVMY
EDNSISSAPPPYTAYATPSPEIYGYPPYNGAYPPPGPQIIYTSNGQTYAIPYQYPNQGPY
GHAPANHVIIRERYRDNDGDLALGMLAGAATGMALGSLFWVF
Download sequence
Identical sequences G1KDD2
XP_003218444.1.98722 XP_008104690.1.98722 XP_016847634.1.98722 ENSACAP00000004840 28377.ENSACAP00000004840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]