SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000005778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000005778
Domain Number 1 Region: 141-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.84e-68
Family Tandem AAA-ATPase domain 0.0000513
Further Details:      
 
Domain Number 2 Region: 315-543
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.67e-53
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000005778
Domain Number - Region: 555-580
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000126
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000005778
Sequence length 599
Comment (Anolis carolinensis)
Sequence
DDDDGEDDYYQPYVPVKLRKQQRQQQLLQMRRKGALEEEQRDSGSDYHGDEDDIPLGPQS
NVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDDPIK
TSWRAPRYVLAMSEARHDRVRKKYHILVEGEAIPPPLKSFKEMKFPAAILRGLKKKGIQQ
PTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLII
CPSRELARQTHGILEYYCRLLHEDGMPSLRCALCIGGMSVKEQMETIKHGVHMMVATPGR
LMDLLQKKMVSLDVCRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQ
NFAKSALVKPITINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKTPPPVLIFAEKKA
DVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFRDGKKDVLVATDVASKGLDFPAIQH
VINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVL
QVLHCGDESMLDIGDERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF
Download sequence
Identical sequences 28377.ENSACAP00000005778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]