SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000006419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000006419
Domain Number 1 Region: 55-152,184-210
Classification Level Classification E-value
Superfamily SH2 domain 6.85e-31
Family SH2 domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily SH3-domain 8.95e-21
Family SH3-domain 0.000037
Further Details:      
 
Domain Number 3 Region: 154-198
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000129
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000006419
Sequence length 217
Comment (Anolis carolinensis)
Sequence
MEAVAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLGKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEEGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNRNI
Download sequence
Identical sequences G1KFH8
ENSACAP00000006419 28377.ENSACAP00000006419 XP_003217257.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]