SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008083
Domain Number 1 Region: 148-345
Classification Level Classification E-value
Superfamily E set domains 2.19e-80
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000118
Further Details:      
 
Domain Number 2 Region: 38-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.88e-23
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008083
Sequence length 426
Comment (Anolis carolinensis)
Sequence
INGHSQNGKSHVTRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMFM
IFSATFLVSWLFFGLLFWIIAFFHGDLDAPSAGNDPSTTKLCIKHVSGFSGAFLFSVETQ
TTIGYGFRYVTEECPLAIMVVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAV
ISLRDGKLCLMWRVGNLRRSHIVEAHVRAQLIKPYMTAEGEYVPLDQRDLNVGYDIGLDR
IFLVSPIIIIHEIDEESPLYAMGKEDLEREDFEIVVILEGMVEATAMTTQARSSYLASEI
LWGHRFEPVVFEDKKRYRVDYSRFHKTYEVAGTPCCSARELQESKITILPSPPPPPSAFC
YENELALVSQDEEDDDNLHVRADLGGGTKEDEGVIPMMEFGSHMDLDRLQVSIPLDTLSY
HRESAI
Download sequence
Identical sequences 28377.ENSACAP00000008083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]