SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008110
Domain Number 1 Region: 222-393
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.35e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0094
Further Details:      
 
Domain Number 2 Region: 78-218
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.31e-37
Family Poly(A) polymerase, PAP, N-terminal domain 0.029
Further Details:      
 
Domain Number 3 Region: 458-488
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000349
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Domain Number 4 Region: 414-445
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000576
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000008110
Domain Number - Region: 38-62
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000131
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008110
Sequence length 733
Comment (Anolis carolinensis)
Sequence
SATSHNCQAVGEIQDTNDEIATEDMHYVFDKFILTSGKPPTIVCSICKRDGHSKNDCPED
FKKIDLKPLPPMTSRFREILDLVCKRCFDELSPPFSEQQNREQILASLERFIRKEYNDKA
RLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNCKEIIENLAKVLKKHPGLRNILPIT
TAKVPIVKFEHRRSGLEGDISLYNTLAKHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDI
GDASRGSLSSYAYILMVLYFLQQREPPVIPVLQEIFDGQQIPQRMVDGWNAFFFDDTEEL
KKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIED
PFDLNHNLGAGVSRKMTNFIMKALINGRKLFGTPFYPVLGREAEYFFNSKVLTDGELAPN
DRCCRVCGKIGHYMKDCPKRRRLKKKENEREDEKEVKEEDRDTREKRCFICGDVGHVRRD
CPEFKQTRQRSNGIQAAQLVRSLVNAQPVTGSIPQQVERPLRTRQPSECSDSHPSSYSPQ
PQQFTQNSSPPASINQTQPQPIAPSNHVLQPQPGTQVQLPLFNFAQSPPGQYPNLPNLGL
FQMHHHQIQLPNTSWPVIHSAPGNPSHATNSSLSLNDPSIIFAQPAARPVGIPSNSPEGH
WHNSVTLSSLVNNGTFGKTNPSPAAAAAPWDHGSPAHFPLLRGTWPYSMSPNYVQQGNAS
YPLNKPFYPQGTR
Download sequence
Identical sequences 28377.ENSACAP00000008110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]