SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009102 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000009102
Domain Number 1 Region: 9-591
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 3.79e-162
Family Prokaryotic type I DNA topoisomerase 0.0000152
Further Details:      
 
Domain Number 2 Region: 620-662
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000146
Family PhnA zinc-binding domain 0.052
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000009102
Domain Number - Region: 933-966
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00034
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009102
Sequence length 968
Comment (Anolis carolinensis)
Sequence
DMTFRNIQKVLCVAEKNDAARGIADILSNSRMRRREGFSKFNKIYECQYHLLGQNVTVVM
TSVSGHLLAHDFKLPFRKWHSCNPLVLFDAEIEKFCPENYLDIKRTLEREVQQCQALVIW
TDCDREGENIGFEVIDVCKAVKPSLQVFRARFSEITPRAIKTACENLTQPDQNVNDAVDV
RQELDLRIGAAFTRFQTMRLQKIFPEVLAEQLISYGSCQFPTLGFVVERFKAIQAFVAET
FYKIKVTHDHEEGTVDFSWKRNRLFNHTACLILYQMCMEDPLATVVEVGSRPKSKWRPLP
LDTVELEKLASRKLKINAKETMKIAEKLYTQGYISYPRTETNIFPKDLNLPNLVQLQTLD
PRWGAFAQRILDQGGPTPRSGTKSDQAHPPIHPTKHATNLQGNDQRLYEFIVRHFLACCS
QDAKGQETTVEIDVANERFVAHGLMILARNYLEVYPYEKWSDKVIPVYEKGSRFQPSTVE
MVEGETSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLTPDQRFVPGELGM
GLVEGYDSMGYEMSKPDLRAELEHDLKLICEGKKGKAVVLREQVQKYKRVFIEAVQKAKK
LDEALAQYFGQGAPLTQEEEIYPALPDPVRKCPQCNSDMVLKTKKSGGFYLSCLGYPSCK
SAVWFPDSVLEVSKDDSVCDVCRPHPVHRLKLKFKRGGLPPMMPLEFVGCIGGCDETLRE
VLDLRYLQGPPRPASQPANRLVSPLQANHSLNHMTGNSNNHQGVSAPPSRPNRTAASEDN
NAVVCNCGEEALFLTVRKEGPNQGRQFYKCRSGGCGFFLWADQQPDSAVSNVPSGFGPFD
PSQRGERGAARSWSEGGGGGGTAVCKCGQPAITRTVQREGANKGRQFHTCAKPREQQCGF
FQWTDENVVPGKGRRGLMVDEGTTRGLGTKTKRSDSDPGLRAPTTKRSRTCGVCHQPGHT
RKTCPQNR
Download sequence
Identical sequences 28377.ENSACAP00000009102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]