SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  28377.ENSACAP00000009121
Domain Number - Region: 122-199
Classification Level Classification E-value
Superfamily Colicin E3 receptor domain 0.00222
Family Colicin E3 receptor domain 0.006
Further Details:      
 
Domain Number - Region: 93-121
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00356
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009121
Sequence length 213
Comment (Anolis carolinensis)
Sequence
SSNPGSRRSRPRETTEAERQERKEQRRRSRDAQQIQQIQHLESFYEKLPPGFIKEDETKP
EDCIPDVPGNENAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRYGHRTGDKECPFFIKGN
QKLEQFRVAHEDPMYDIIRENKRHEKEMRIQQLKQLLEASTSDSSSDSSSSSSCHEKGKK
KRKKEKKKEKKKKKKKRKHKSKSDKSSSASDGD
Download sequence
Identical sequences 28377.ENSACAP00000009121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]