SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000010438 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000010438
Domain Number 1 Region: 199-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-49
Family Tandem AAA-ATPase domain 0.00043
Further Details:      
 
Domain Number 2 Region: 40-67
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000785
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000010438
Sequence length 872
Comment (Anolis carolinensis)
Sequence
GNFVCLNLKKRSHVKGFALRGKHLRKQVWKQKWQKKGELFGGGGGGRSSDTCFRCGEVGH
WASQCKGKVINTDENGCDAEEEVPLLTLEEVAQMTNTAYSKVSGEKDRLEGPTYEPPPPP
KPIEPLYGLGPDAKVKETPPEVFQALAELGFTSFRAGQETAVMRILSGLSTLVVLSTGMG
KSLCYQLPAYLYSKRSTCITLVISPLVSLMDDQVSGLPQHLKAVCIHSNMSKTQREAAME
KVKAGKVHVLLLSPEALVGGGLSGSSCLPPADQLPPVAFACIDEAHCVSEWSHNFRPCYL
RLCKVLRERLGVRCFLGLTATATLSTARDVAHHLGISGGEGIAVRSAAVPPNLHLSVSTD
RDKDQALLSLLQGERFGGLDSIIIYCTRREETARIAALIRTCLQGRAVPLRKGRNPKWIA
DAYHAGLSSAERRRVQNNFMSGQLRVVAATVAFGMGLDKSDVRGVIHYNMPKNFESYVQE
IGRAGRDGKPAHCHLFLHPEGEDLHELRRHIYADTVDFFTVKRLVQKVFPRCKCRELHQK
QQQLSKESGGENPSSGAGQQRVCYRHERAIPIQPTVEALDFREEGIETLLCYLELHPQRW
LEMLHPTFSSCRVICYGGPQQLRTVAQRCPPLAVCLAQQRLQGISHTHASSVDFDVVALA
DSMGWEVLPVKRALRQLQWDTRLQNGNQASSYGVLVEFSELSFYLRSYGDLTDEELDSVC
EFLHRRVMDREKAALSQLQVCFQAFQRVAFRSCASCCDDVGEERSNQLKTLLMEYFEKDE
ADYEHGDEGMDAKDLQDIKFRDWEDQIRADVRHFLSIRQDEKFSGRAVARILHGIGSPCF
PAQIYGRDRRFWRKYIHFDFNRIMRLATEEII
Download sequence
Identical sequences 28377.ENSACAP00000010438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]