SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000010762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000010762
Domain Number 1 Region: 170-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000249
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 
Domain Number 2 Region: 115-164
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000183
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000010762
Sequence length 262
Comment (Anolis carolinensis)
Sequence
MTRWARSNVTHSKKALDATPWEDMKNDAGNIKKDDRQTFGNKLSVKSTQEKKKNKKKKDY
LNEDVNGFMEYLKQNSQALHNGQVINSHEVREEIATALKKDQRREGRRIKRQEVKKNAMV
CFHCRQPGHGVADCPAVLESQDMGTGICFRCGSTEHEISKCRAKIDPALGEFPYAKCFIC
GEMGHLSRSCPDNPKGLYAHGGSCRICGSVEHFKRDCPENQSSDCVVTVGRWMKGMSADY
QETLESPKQPKPKQKPSKVVNF
Download sequence
Identical sequences G1KKP7
ENSACAP00000010762 ENSACAP00000010762 XP_003216322.1.98722 XP_008101202.1.98722 28377.ENSACAP00000010762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]