SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011585
Domain Number 1 Region: 186-273
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-21
Family RING finger domain, C3HC4 0.055
Further Details:      
 
Domain Number 2 Region: 94-124
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000645
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011585
Sequence length 1755
Comment (Anolis carolinensis)
Sequence
EYTDDNALIPKNSSVIVRRIPIGGVKCTSKTYVISRTEPVSGPSKAIDDSSASISLAQLT
KTANLAEANASEEDKIKAMMSQSGHEYDPINYMKKAPGPPPPTYTCFRCGKPGHYIKICP
TNGDKNFESGPRIKKSTGIPRSFMMEVQDPNTKGAMLTNTGKYAIPTIDAEAYAIGKKEK
PPFLPEEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESEEHT
CPTCHQIDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQPPPPRPVVQRSLPSAPRPPG
PRQQDPLLASAAPAPLHPAVPLALPLPPVQSASAAGALPLKPSVVPSPGEVPASLALALH
ADKPDGPFRESDGIGPAVALMAASDHPKPLSSLSINTVLEEKGYQVPVLGQPLLGGQLGP
HGHSIPSMGQPMRPSLLRSAGSRSGWEPNPALGAIVSGWGLLGDKVFLGFFRSSNRGRPH
NDRTQRTQAPTLPASTPVFVPVPPPPPPPLYPHPPPPHALPLPPGVPPPQFPPQFPPGQP
PPAGYVVPPPGFPPAPGNLSTPWVPTPVPTAHSNAIPTTQAPPLSREEFYREQRRLKEEE
KKKSKLDEFTNDFAKELMEYKKIQKERRRSYSRSKSPYSASSYSRSSYTYSKSRSGSSRS
RSYSRSFSRSHSRSYSRSPPYPRRARAKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRS
PVYRAQSPNKHPPVPQPEGEREYFGRFREVPVYDMKAYYGRPVDVRDPYEKERLHNWEIR
YREWEKYYKGFLPGAQPRPLLNRENFSPERFGPLGPRRDNSPYIRGRRDEFPTALGHRNR
NIGGGGYPEKLPGRESHGLKDMAKPKEKEVENPPGDAKGNKHKKHRRRRREEGEGFLSAD
PLEGSRKPRDPPSSTGEDGKPDPLFVPPSRDDGTPVRDEPMDADSVAFKPISDKERKEKP
KAKVEKAKRKMDAPAAPKETQAKPSKAPQEKVEADRDKSPRAEPPTKKVKEEMPKADSAK
TSSSQKEEKPVGTPRKAHPRGAKEHPDSRSGKEEKSKKEHSSKDVKPEKLASKEEKAKKP
LDKGKPVEVKPEKRKRKTEEKGDSKEQEAASSKTPKPESAESKPAPKGVKAEPEDEKSEK
TPEKDKTVLPAVPAKKIKLNRETGKKIASTENAPPAKEALAEKPEPTTSSKVKPEKTKGK
MRRKVAMTDGTGSTLVDYTSTSSAGGSPVKKAEDKLDTKRTVIKTMEEYNNDITAPAEDV
IIMIQVPQSKWDKDDFDSEEEEEQAATKPVQVPSVIKNVSAKQPSTHLKQNEKEPDPPSE
KTQKTNKETSRETLGQSEPKSSKSSSSSEKGKAKDRDHAVSERDSSEKRKSGPQLEKERS
EHSTELGNPRASSSSHSSRESRAPEKHDATHTSSSSAKDFTPSREKKHDHESSRDHSGSK
RREERSDPSRKRASPSRPRESSSSTSGTKNKGREERTEPPKKEAWDPKRSSYSPSRERRP
NEHKAAAHDSRRLSAEQHKSQERGSGKEREKRPLSSERRSTKEKATGGGSKASHRPRGGS
LETRDPGAGSEKSAPKPPKPQLSHTSRLSSDPTRETDEAAFVPDYNESDSDSNASAKAEE
PKEGKDKNAAANNLPKEAITAGPGAGTATSATAPAAEGSQSTSSPSPSRSPSESAGRSRS
SSPSSADSQDSKKKRKKKEKKKHKKHKKHKKHKKHAGPEAEAEKSQKHKHKKKKSKKSKD
KEKEKDDQKAKPPVP
Download sequence
Identical sequences 28377.ENSACAP00000011585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]