SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011586
Domain Number 1 Region: 206-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000051
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011586
Sequence length 231
Comment (Anolis carolinensis)
Sequence
VPERFDGAREKLPTFLAQVDLYFLQISDLSFPTDTNKVAFILSLLTGPAGRWAVNVIRGN
SPIKNNLVDFKAALTETFGDPLQKENAGWALYRLKQGKGSLIDYLNKFNLLKHQLDWGEH
AFMLAFTAGLNDGLQDELSRVEPAQNWDELVTKVCRIEAQLDRSKASRSRRHPAASTPLP
RGAGHQLVDPEQPLGNVRPRLDAAEKARRQRLNLCWYCGNGGHFARECPAK
Download sequence
Identical sequences 28377.ENSACAP00000011586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]