SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011593
Domain Number 1 Region: 262-386
Classification Level Classification E-value
Superfamily PX domain 0.00000000000567
Family PX domain 0.0091
Further Details:      
 
Domain Number 2 Region: 1016-1042
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000115
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011593
Sequence length 1072
Comment (Anolis carolinensis)
Sequence
EAVYEWFGLSLGLAQRLEFAVGLLDLLNPLELRFLGSCLEELARKDYHCLRDSEAKANGA
AAEAGSAGTGLPQPPQPLPPSSPPAASDFRDPATRSRLIVYLALLGSENREAAGRLHRLL
PPVDAILRSCRRPPLGPLPGHEGGEEEEEGAGARPGPAEEGLGLGPAAREELLLLFTMAS
LHPAFSFHQRVTLREHLERLRRALCRDDGDGRDDGYACHAGSSPNVPHNCMPSNESSLLE
QRVALHDKSMVTSHRPQQEAVHIQKIMLKGGPRKRSDKHLEYTFKVIWSDHSTSCVTKTH
QELQEFLLKLPRDLSSEAFDKTILGALHQGLQKQEERRYPDLEPMIRQLFSTTSQAFLQN
QKVNNFFQSLSSESLHAQNNFQSSLKTSKIPEHFKEDSSEASSQEEEIIQHTAIHKKHNG
KCPVANTVNTKCSSLDGFGITHSEHNGVPDWRRKGCALQQHPEHCTMLDQNTGDKRNLPV
MNKKKGKLQPEKDKGKRNDNRLAIRSNCVRVADTYDLHPGITKDSNLDVTVGHDTCGETS
SESYSSPSSPRHDGRESFESEEEKDRDTDSNSEDSGNPNMMRFTGYGSADLTKSSAQLSV
RSDNPNIVEDALNPQFQHISFMPSLHCVVLNGAQKPETVVPPPIPTDGKALGMVVTNSTP
VGMGLVGESEKPIELLPSPLPANFLPPAIQPGSPALHVAVHRMKMPPPQASSESCAVSGA
PPQQTGNLSIGSPTTAFIPVHNPGNFPGSTVPTTDPVSKPASHVLGLNQMVPHVEGSAGV
ISQSSSLKVVVSAAGLSTALPPAPFPVPVTLHATSVLPNQSSTVLNTVASTPPPPPPPSS
GLCVSQVQPTVPPAIPTHTPGPAPSPSPALTHSTAQSDSTSYISAAGNTNANGTLLSPQQ
LGSGPCGSCGRRCSCGTNGSLPINSYFYHNPLPGQVYRVPPFFTLPSLCNGSYLNQAHQT
NGTQIPFYLHRSPYPNGLMHDPVMGSQTNYGMQQMAGYGRFYPMYPAQNVVANTNASCPK
KNGNVSCYNCGVSGHYAQDCKQSSMEASQQGTYRLRYAPPPPPSNDTLDSAD
Download sequence
Identical sequences 28377.ENSACAP00000011593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]